Asialoglycoprotein Receptor 1 anticorps (N-Term)

N° du produit ABIN629649

Détail du produit anti-Asialoglycoprotein Receptor 1 anticorps

Antigène: Asialoglycoprotein Receptor 1 (ASGR1)

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Asialoglycoprotein Receptor 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASGR1 antibody was raised against the N terminal of ASGR1

Purification: Purified

Immunogène: ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS

Information d'application

Indications d'application: WB: 0.6 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASGR1 Blocking Peptide, catalog no. 33R-8004, is also available for use as a blocking control in assays to test for specificity of this ASGR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Asialoglycoprotein Receptor 1

Antigène: Asialoglycoprotein Receptor 1 (ASGR1)

Autre désignation: ASGR1 (ASGR1 Produits)

Synonymes: anticorps ASGR1, anticorps ASGPR, anticorps ASGPR1, anticorps CLEC4H1, anticorps HL-1, anticorps Asgr, anticorps Asgr-1, anticorps ASGR, anticorps RATRHL1, anticorps RHL1, anticorps asialoglycoprotein receptor 1, anticorps LOC721786, anticorps ASGR1, anticorps LOC489461, anticorps Asgr1, anticorps LOC101116157

Sujet: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis