UPB1 anticorps (Middle Region)

N° du produit ABIN629651

L’anticorps Lapin Polyclonal anti-UPB1 a été validé pour WB. Il convient pour détecter UPB1 dans des échantillons de Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster, Arabidopsis et C. elegans.

Aperçu rapide pour UPB1 anticorps (Middle Region) (ABIN629651)

Antigène: UPB1 (Ureidopropionase, beta (UPB1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UPB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UPB1 anticorps

Épitope: Middle Region

Specificité: UPB1 antibody was raised against the middle region of UPB1

Purification: Purified

Immunogène: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPB1 Blocking Peptide, (ABIN937005), is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UPB1

Antigène: UPB1 (Ureidopropionase, beta (UPB1))

Autre désignation: UPB1

Sujet: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Poids moléculaire: 42 kDa (MW of target protein)