ACAT2 anticorps

N° du produit ABIN629655

Cet anticorps anti-ACAT2 est un anticorps Lapin Polyclonal détectant ACAT2 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour ACAT2 anticorps (ABIN629655)

Antigène: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ACAT2 anticorps

Purification: Purified

Immunogène: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAT2 Blocking Peptide, (ABIN5611884), is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAT2

Antigène: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Autre désignation: ACAT2

Sujet: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Poids moléculaire: 41 kDa (MW of target protein)