Adenylate Kinase 2 anticorps (N-Term)

N° du produit ABIN629660

L’anticorps Lapin Polyclonal anti-Adenylate Kinase 2 a été validé pour WB. Il convient pour détecter Adenylate Kinase 2 dans des échantillons de Humain.

Aperçu rapide pour Adenylate Kinase 2 anticorps (N-Term) (ABIN629660)

Antigène: Adenylate Kinase 2 (AK2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adenylate Kinase 2 anticorps

Épitope: N-Term

Specificité: AK2 antibody was raised against the N terminal of AK2

Purification: Purified

Immunogène: AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK2 Blocking Peptide, (ABIN5611983), is also available for use as a blocking control in assays to test for specificity of this AK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 2

Antigène: Adenylate Kinase 2 (AK2)

Autre désignation: AK2

Sujet: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process