Adenylate Kinase 2 anticorps (N-Term)

N° du produit ABIN629660

Détail du produit anti-Adenylate Kinase 2 anticorps

Antigène: Adenylate Kinase 2 (AK2)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AK2 antibody was raised against the N terminal of AK2

Purification: Purified

Immunogène: AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK2 Blocking Peptide, catalog no. 33R-5718, is also available for use as a blocking control in assays to test for specificity of this AK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 2

Antigène: Adenylate Kinase 2 (AK2)

Autre désignation: AK2 (AK2 Produits)

Synonymes: anticorps ADK-2, anticorps BcDNA:SD09634, anticorps CG3140, anticorps Dak2, anticorps Dmel\\CG3140, anticorps anon-Dak2, anticorps adk2, anticorps NV10896, anticorps wu:fb34f05, anticorps wu:fj80e03, anticorps ADK2, anticorps AK 2, anticorps Ak-2, anticorps D4Ertd220e, anticorps MXI22.8, anticorps MXI22_8, anticorps Adenylate kinase 2, anticorps adenylate kinase 2, anticorps adenylate kinase, anticorps adenylate kinase 2 S homeolog, anticorps Adenylate kinase family protein, anticorps Adk2, anticorps AK2, anticorps ak2, anticorps LOC100123971, anticorps ak2.S, anticorps Ak2, anticorps AT5G50370

Sujet: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process