ALAS2 anticorps

N° du produit ABIN629674

Cet anticorps Lapin Polyclonal détecte spécifiquement ALAS2 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ALAS2 anticorps (ABIN629674)

Antigène: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALAS2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ALAS2 anticorps

Purification: Purified

Immunogène: ALAS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALAS2 Blocking Peptide, (ABIN5612004), is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALAS2

Antigène: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Autre désignation: ALAS2

Sujet: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis