ECH1 anticorps (N-Term)

N° du produit ABIN629677

Détail du produit anti-ECH1 anticorps

Antigène: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECH1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ECH1 antibody was raised against the N terminal of ECH1

Purification: Purified

Immunogène: ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECH1 Blocking Peptide, catalog no. 33R-7014, is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECH1

Antigène: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Autre désignation: ECH1 (ECH1 Produits)

Synonymes: anticorps HPXEL, anticorps Pxel, anticorps AA617331, anticorps enoyl-CoA hydratase 1, peroxisomal, anticorps enoyl CoA hydratase 1, peroxisomal, anticorps enoyl-CoA hydratase 1, anticorps delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial, anticorps enoyl-CoA hydratase 1, peroxisomal L homeolog, anticorps enoyl coenzyme A hydratase 1, peroxisomal, anticorps ech1, anticorps ECH1, anticorps LOC747511, anticorps ech1.L, anticorps Ech1

Sujet: ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process