CPS1 anticorps (N-Term)

N° du produit ABIN629684

L’anticorps Lapin Polyclonal anti-CPS1 a été validé pour WB et IHC. Il convient pour détecter CPS1 dans des échantillons de Humain.

Aperçu rapide pour CPS1 anticorps (N-Term) (ABIN629684)

Antigène: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CPS1 anticorps

Épitope: N-Term

Specificité: CPS1 antibody was raised against the N terminal of CPS1

Purification: Purified

Immunogène: CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPS1 Blocking Peptide, (ABIN5612985), is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPS1

Antigène: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Autre désignation: CPS1

Sujet: Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.

Poids moléculaire: 165 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Glucan Metabolic Process