MDH1 anticorps

N° du produit ABIN629689

Détail du produit anti-MDH1 anticorps

Antigène: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Reactivité: Humain, Souris, Rat, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDH1 Blocking Peptide, catalog no. 33R-6690, is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDH1

Antigène: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Autre désignation: MDH1 (MDH1 Produits)

Synonymes: anticorps MDH-s, anticorps MDHA, anticorps MGC:1375, anticorps MOR2, anticorps ODS1, anticorps B230377B03Rik, anticorps D17921, anticorps Mor-2, anticorps Mor2, anticorps MDL1, anticorps Mdhl, anticorps MDH, anticorps mdh-s, anticorps mdha, anticorps mor2, anticorps MDH-1, anticorps Mdh, anticorps Mdh-1, anticorps Mdh2, anticorps MdhD, anticorps cMdh, anticorps sMdh, anticorps malate dehydrogenase 1, anticorps malic enzyme 2, anticorps malate dehydrogenase 1, NAD (soluble), anticorps malate dehydrogenase 1 S homeolog, anticorps malate dehydrogenase, cytoplasmic, anticorps Malate dehydrogenase 1, anticorps MDH1, anticorps ME2, anticorps Mdh1, anticorps mdh1.S, anticorps LOC100280767

Sujet: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Poids moléculaire: 36 kDa (MW of target protein)