OTC anticorps (N-Term)

N° du produit ABIN629690

L’anticorps Lapin Polyclonal anti-OTC a été validé pour WB et IHC. Il convient pour détecter OTC dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour OTC anticorps (N-Term) (ABIN629690)

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-OTC anticorps

Épitope: N-Term

Specificité: OTC antibody was raised against the N terminal of OTC

Purification: Purified

Immunogène: OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OTC Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this OTC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OTC

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Autre désignation: OTC

Sujet: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.

Poids moléculaire: 39 kDa (MW of target protein)