NDRG1 anticorps (N-Term)

N° du produit ABIN629694

Cet anticorps anti-NDRG1 est un anticorps Lapin Polyclonal détectant NDRG1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour NDRG1 anticorps (N-Term) (ABIN629694)

Antigène: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDRG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NDRG1 anticorps

Épitope: N-Term

Specificité: NDRG1 antibody was raised against the N terminal of NDRG1

Purification: Purified

Immunogène: NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDRG1 Blocking Peptide, (ABIN5614939), is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDRG1

Antigène: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Autre désignation: NDRG1

Sujet: NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Poids moléculaire: 43 kDa (MW of target protein)