NDRG1 anticorps (N-Term)
-
- Antigène Voir toutes NDRG1 Anticorps
- NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDRG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NDRG1 antibody was raised against the N terminal of NDRG1
- Purification
- Purified
- Immunogène
- NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
- Top Product
- Discover our top product NDRG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDRG1 Blocking Peptide, catalog no. 33R-6485, is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))
- Autre désignation
- NDRG1 (NDRG1 Produits)
- Synonymes
- anticorps CAP43, anticorps CMT4D, anticorps DRG-1, anticorps DRG1, anticorps GC4, anticorps HMSNL, anticorps NDR1, anticorps NMSL, anticorps PROXY1, anticorps RIT42, anticorps RTP, anticorps TARG1, anticorps TDD5, anticorps Ndr1, anticorps Ndrl, anticorps cap43, anticorps cmt4d, anticorps drg1, anticorps gc4, anticorps hmsnl, anticorps ndr1, anticorps ndrg1, anticorps nmsl, anticorps proxy1, anticorps rit42, anticorps rtp, anticorps targ1, anticorps tdd5, anticorps xndrg1, anticorps ndrg4, anticorps cb775, anticorps wu:fb60h02, anticorps zgc:63944, anticorps NDRG1, anticorps NON-RACE SPECIFIC DISEASE RESISTANCE PROTEIN, anticorps non race-specific disease resistance 1, anticorps ndrg1-a, anticorps ndrg1-b, anticorps xNDRG1-A, anticorps ndrg1l, anticorps zgc:73047, anticorps N-myc downstream regulated 1, anticorps N-myc downstream regulated gene 1, anticorps N-myc downstream regulated 1 S homeolog, anticorps N-myc downstream regulated 1a, anticorps Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family, anticorps N-myc downstream regulated 1 L homeolog, anticorps N-myc downstream regulated 1b, anticorps NDRG1, anticorps Ndrg1, anticorps ndrg1.S, anticorps ndrg1, anticorps ndrg1a, anticorps NDR1, anticorps ndrg1.L, anticorps ndrg1b
- Sujet
- NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.
- Poids moléculaire
- 43 kDa (MW of target protein)
-