PNPLA5 anticorps (N-Term)

N° du produit ABIN629699

L’anticorps anti-PNPLA5 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de PNPLA5 dans des échantillons provenant de Humain. }

Aperçu rapide pour PNPLA5 anticorps (N-Term) (ABIN629699)

Antigène: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPLA5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PNPLA5 anticorps

Épitope: N-Term

Specificité: PNPLA5 antibody was raised against the N terminal of PNPLA5

Purification: Purified

Immunogène: PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPLA5 Blocking Peptide, (ABIN5615441), is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPLA5

Antigène: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Autre désignation: PNPLA5

Sujet: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

Poids moléculaire: 48 kDa (MW of target protein)