WDR13 anticorps (N-Term)

N° du produit ABIN629704

Détail du produit anti-WDR13 anticorps

Antigène: WDR13 (WD Repeat Domain 13 (WDR13))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR13 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR13 antibody was raised against the N terminal of WDR13

Purification: Purified

Immunogène: WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR13 Blocking Peptide, catalog no. 33R-3511, is also available for use as a blocking control in assays to test for specificity of this WDR13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR13

Antigène: WDR13 (WD Repeat Domain 13 (WDR13))

Autre désignation: WDR13 (WDR13 Produits)

Synonymes: anticorps MGC80988, anticorps MGC79608, anticorps WDR13, anticorps DKFZp469E2032, anticorps MG21, anticorps 1700060B08Rik, anticorps 5730411P10Rik, anticorps DXHXS7467e, anticorps W51679, anticorps mMg21, anticorps RGD1560982, anticorps WD repeat domain 13 L homeolog, anticorps WD repeat domain 13, anticorps wdr13.L, anticorps wdr13, anticorps WDR13, anticorps Wdr13

Sujet: WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.

Poids moléculaire: 53 kDa (MW of target protein)