ASS1 anticorps (N-Term)

N° du produit ABIN629706

Cet anticorps anti-ASS1 est un anticorps Lapin Polyclonal détectant ASS1 dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour ASS1 anticorps (N-Term) (ABIN629706)

Antigène: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ASS1 anticorps

Épitope: N-Term

Specificité: ASS1 antibody was raised against the N terminal Of Ass

Purification: Purified

Immunogène: ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASS1 Blocking Peptide, (ABIN936216), is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASS1

Antigène: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Autre désignation: ASS1

Sujet: ASS catalyzes the penultimate step of the arginine biosynthetic pathway.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin