ASS1 anticorps (N-Term)
-
- Antigène Voir toutes ASS1 Anticorps
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASS1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ASS1 antibody was raised against the N terminal Of Ass
- Purification
- Purified
- Immunogène
- ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
- Top Product
- Discover our top product ASS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASS1 Blocking Peptide, catalog no. 33R-10240, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
- Autre désignation
- ASS1 (ASS1 Produits)
- Synonymes
- anticorps ASS, anticorps CTLN1, anticorps AA408052, anticorps Ass-1, anticorps fold, anticorps ASSA, anticorps Ass, anticorps ass, anticorps zgc:92051, anticorps wu:fb95a04, anticorps wu:fc01e08, anticorps argininosuccinate synthase 1, anticorps argininosuccinate synthetase 1, anticorps argininosuccinate synthase 1 S homeolog, anticorps ASS1, anticorps Ass1, anticorps ass1.S, anticorps ass1
- Sujet
- ASS catalyzes the penultimate step of the arginine biosynthetic pathway.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin
-