HMGCS2 anticorps

N° du produit ABIN629710

Cet anticorps Lapin Polyclonal détecte spécifiquement HMGCS2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour HMGCS2 anticorps (ABIN629710)

Antigène: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGCS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HMGCS2 anticorps

Purification: Purified

Immunogène: HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMGCS2 Blocking Peptide, (ABIN5614028), is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMGCS2

Antigène: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Autre désignation: HMGCS2

Sujet: HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha