LIM Domain Binding 3 Protein anticorps (N-Term)

N° du produit ABIN629714

Détail du produit anti-LIM Domain Binding 3 Protein anticorps

Antigène: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIM Domain Binding 3 Protein est non-conjugé

Application: Western Blotting (WB)

Specificité: LDB3 antibody was raised against the N terminal of LDB3

Purification: Purified

Immunogène: LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS

Information d'application

Indications d'application: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDB3 Blocking Peptide, catalog no. 33R-7412, is also available for use as a blocking control in assays to test for specificity of this LDB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIM Domain Binding 3 Protein

Antigène: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Autre désignation: LDB3 (LDB3 Produits)

Synonymes: anticorps CMD1C, anticorps CYPHER, anticorps LDB3Z1, anticorps LDB3Z4, anticorps LVNC3, anticorps MFM4, anticorps ORACLE, anticorps PDLIM6, anticorps ZASP, anticorps AW742271, anticorps ldb3l, anticorps zgc:55814, anticorps wu:fi31d08, anticorps ldb3, anticorps MGC52706, anticorps MGC75668, anticorps RGD1564875, anticorps LDB3, anticorps cypher, anticorps hm:zehn1639, anticorps zehn1639, anticorps LIM domain binding 3, anticorps LIM domain binding 3b, anticorps LIM domain binding 3 S homeolog, anticorps LIM domain binding 3a, anticorps LDB3, anticorps Ldb3, anticorps ldb3b, anticorps ldb3.S, anticorps ldb3, anticorps ldb3a

Sujet: LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

Poids moléculaire: 36 kDa (MW of target protein)