RSU1 anticorps (C-Term)

N° du produit ABIN629715

Cet anticorps anti-RSU1 est un anticorps Lapin Polyclonal détectant RSU1 dans WB et IHC. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RSU1 anticorps (C-Term) (ABIN629715)

Antigène: RSU1 (Ras Suppressor Protein 1 (RSU1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSU1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RSU1 anticorps

Épitope: C-Term

Specificité: RSU1 antibody was raised against the C terminal of RSU1

Purification: Purified

Immunogène: RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSU1 Blocking Peptide, (ABIN5615969), is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSU1

Antigène: RSU1 (Ras Suppressor Protein 1 (RSU1))

Autre désignation: RSU1

Sujet: RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.

Poids moléculaire: 31 kDa (MW of target protein)