FBXO25 anticorps (C-Term)

N° du produit ABIN629736

Cet anticorps anti-FBXO25 est un anticorps Lapin Polyclonal détectant FBXO25 dans WB et IHC. Adapté pour Humain, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour FBXO25 anticorps (C-Term) (ABIN629736)

Antigène: FBXO25 (F-Box Protein 25 (FBXO25))

Reactivité: Humain, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO25 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FBXO25 anticorps

Épitope: C-Term

Specificité: FBXO25 antibody was raised against the C terminal of FBXO25

Purification: Purified

Immunogène: FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO25 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FBXO25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO25

Antigène: FBXO25 (F-Box Protein 25 (FBXO25))

Autre désignation: FBXO25

Sujet: FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO25 belongs to the Fbxs class.

Poids moléculaire: 16 kDa (MW of target protein)