FBXL7 anticorps (N-Term)

N° du produit ABIN629737

Cet anticorps Lapin Polyclonal détecte spécifiquement FBXL7 dans WB et IHC. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour FBXL7 anticorps (N-Term) (ABIN629737)

Antigène: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FBXL7 anticorps

Épitope: N-Term

Specificité: FBXL7 antibody was raised against the N terminal of FBXL7

Purification: Purified

Immunogène: FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL7 Blocking Peptide, (ABIN939522), is also available for use as a blocking control in assays to test for specificity of this FBXL7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL7

Antigène: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Autre désignation: FBXL7

Sujet: FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Poids moléculaire: 54 kDa (MW of target protein)