FBXL7 anticorps (N-Term)
-
- Antigène Voir toutes FBXL7 Anticorps
- FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXL7 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- FBXL7 antibody was raised against the N terminal of FBXL7
- Purification
- Purified
- Immunogène
- FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
- Top Product
- Discover our top product FBXL7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXL7 Blocking Peptide, catalog no. 33R-4136, is also available for use as a blocking control in assays to test for specificity of this FBXL7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))
- Autre désignation
- FBXL7 (FBXL7 Produits)
- Synonymes
- anticorps FBXL7, anticorps FBL6, anticorps FBL7, anticorps AL023057, anticorps D230018M15Rik, anticorps Fbl6, anticorps F-box and leucine rich repeat protein 7, anticorps F-box and leucine-rich repeat protein 7, anticorps FBXL7, anticorps Fbxl7
- Sujet
- FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.
- Poids moléculaire
- 54 kDa (MW of target protein)
-