RNF32 anticorps (Middle Region)

N° du produit ABIN629739

Cet anticorps anti-RNF32 est un anticorps Lapin Polyclonal détectant RNF32 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RNF32 anticorps (Middle Region) (ABIN629739)

Antigène: RNF32 (Ring Finger Protein 32 (RNF32))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF32 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF32 anticorps

Épitope: Middle Region

Specificité: RNF32 antibody was raised against the middle region of RNF32

Purification: Purified

Immunogène: RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF32 Blocking Peptide, (ABIN936459), is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF32

Antigène: RNF32 (Ring Finger Protein 32 (RNF32))

Autre désignation: RNF32

Sujet: RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.

Poids moléculaire: 40 kDa (MW of target protein)