LONRF1 anticorps (N-Term)

N° du produit ABIN629741

Détail du produit anti-LONRF1 anticorps

Antigène: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LONRF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: LONRF1 antibody was raised against the N terminal of LONRF1

Purification: Purified

Immunogène: LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LONRF1 Blocking Peptide, catalog no. 33R-6504, is also available for use as a blocking control in assays to test for specificity of this LONRF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LONRF1

Antigène: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Autre désignation: LONRF1 (LONRF1 Produits)

Synonymes: anticorps RGD1562583, anticorps LONRF1, anticorps RNF191, anticorps LON peptidase N-terminal domain and ring finger 1, anticorps LON peptidase N-terminal domain and RING finger protein 1, anticorps Lonrf1, anticorps LONRF1, anticorps LOC567909, anticorps lonrf1

Sujet: LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding.

Poids moléculaire: 46 kDa (MW of target protein)