RNF39 anticorps (C-Term)

N° du produit ABIN629742

Cet anticorps anti-RNF39 est un anticorps Lapin Polyclonal détectant RNF39 dans WB. Adapté pour Humain.

Aperçu rapide pour RNF39 anticorps (C-Term) (ABIN629742)

Antigène: RNF39 (Ring Finger Protein 39 (RNF39))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF39 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF39 anticorps

Épitope: C-Term

Specificité: RNF39 antibody was raised against the C terminal of RNF39

Purification: Purified

Immunogène: RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF39 Blocking Peptide, (ABIN937184), is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF39

Antigène: RNF39 (Ring Finger Protein 39 (RNF39))

Autre désignation: RNF39

Sujet: Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.

Poids moléculaire: 28 kDa (MW of target protein)