RNF39 anticorps (C-Term)
-
- Antigène Voir toutes RNF39 Anticorps
- RNF39 (Ring Finger Protein 39 (RNF39))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF39 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF39 antibody was raised against the C terminal of RNF39
- Purification
- Purified
- Immunogène
- RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL
- Top Product
- Discover our top product RNF39 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF39 Blocking Peptide, catalog no. 33R-1798, is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF39 (Ring Finger Protein 39 (RNF39))
- Autre désignation
- RNF39 (RNF39 Produits)
- Sujet
- Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.
- Poids moléculaire
- 28 kDa (MW of target protein)
-