alpha Actinin 4 anticorps (N-Term)

N° du produit ABIN629744

Détail du produit anti-alpha Actinin 4 anticorps

Antigène: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp alpha Actinin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Actinin 4 antibody was raised against the N terminal of ACTN4

Purification: Purified

Immunogène: alpha Actinin 4 antibody was raised using the N terminal of ACTN4 corresponding to a region with amino acids LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Information d'application

Indications d'application: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Alpha Actinin 4 Blocking Peptide, catalog no. 33R-5045, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur alpha Actinin 4

Antigène: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Autre désignation: alpha Actinin 4 (ACTN4 Produits)

Synonymes: anticorps fsgs, anticorps fsgs1, anticorps C77391, anticorps ACTININ-4, anticorps FSGS, anticorps FSGS1, anticorps wu:fb53f05, anticorps zgc:63508, anticorps actinin alpha 4, anticorps actinin, alpha 4, anticorps actinin alpha 4 S homeolog, anticorps actn4, anticorps ACTN4, anticorps Actn4, anticorps actn4.S

Sujet: Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Alpha actinin is an actin-binding protein with multiple roles in different cell types.

Poids moléculaire: 100 kDa (MW of target protein)

Pathways: Proton Transport