MAT1A anticorps (N-Term)

N° du produit ABIN629745

Cet anticorps anti-MAT1A est un anticorps Lapin Polyclonal détectant MAT1A dans WB et IHC. Adapté pour Humain, Souris, Rat, Chien, Drosophila melanogaster et C. elegans.

Aperçu rapide pour MAT1A anticorps (N-Term) (ABIN629745)

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAT1A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MAT1A anticorps

Épitope: N-Term

Specificité: MAT1 A antibody was raised against the N terminal of MAT1

Purification: Purified

Immunogène: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAT1A Blocking Peptide, (ABIN5614678), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAT1A

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Autre désignation: MAT1A

Sujet: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process