MAT1A anticorps (N-Term)

N° du produit ABIN629745

Cet anticorps anti-MAT1A est un anticorps Polyclonal produit chez le Lapin, détectant MAT1A dans WB et IHC. Convient pour Humain, Souris, Rat, Chien, Drosophila melanogaster et C. elegans.

Aperçu rapide pour MAT1A anticorps (N-Term) (ABIN629745)

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAT1A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MAT1A anticorps

Épitope: N-Term

Specificité: MAT1 A antibody was raised against the N terminal of MAT1

Purification: Purified

Immunogène: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAT1A Blocking Peptide, (ABIN5614678), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAT1A

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Autre désignation: MAT1A

Sujet: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process