DPYS anticorps (N-Term)

N° du produit ABIN629746

Cet anticorps Lapin Polyclonal détecte spécifiquement DPYS dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour DPYS anticorps (N-Term) (ABIN629746)

Antigène: DPYS (Dihydropyrimidinase (DPYS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPYS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPYS anticorps

Épitope: N-Term

Specificité: DPYS antibody was raised against the N terminal of DPYS

Purification: Purified

Immunogène: DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPYS Blocking Peptide, (ABIN5613255), is also available for use as a blocking control in assays to test for specificity of this DPYS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPYS

Antigène: DPYS (Dihydropyrimidinase (DPYS))

Autre désignation: DPYS

Sujet: Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Poids moléculaire: 56 kDa (MW of target protein)