BHMT anticorps (C-Term)

N° du produit ABIN629748

Cet anticorps anti-BHMT est un anticorps Lapin Polyclonal détectant BHMT dans WB et IHC. Adapté pour Humain et Chien.

Aperçu rapide pour BHMT anticorps (C-Term) (ABIN629748)

Antigène: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BHMT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-BHMT anticorps

Épitope: C-Term

Specificité: BHMT antibody was raised against the C terminal of BHMT

Purification: Purified

Immunogène: BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BHMT Blocking Peptide, (ABIN939800), is also available for use as a blocking control in assays to test for specificity of this BHMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BHMT

Antigène: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Autre désignation: BHMT

Sujet: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process