BHMT anticorps (C-Term)

N° du produit ABIN629748

Détail du produit anti-BHMT anticorps

Antigène: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BHMT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: BHMT antibody was raised against the C terminal of BHMT

Purification: Purified

Immunogène: BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BHMT Blocking Peptide, catalog no. 33R-4414, is also available for use as a blocking control in assays to test for specificity of this BHMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BHMT

Antigène: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Autre désignation: BHMT (BHMT Produits)

Synonymes: anticorps BHMT1, anticorps hm:zehn2153, anticorps wu:fb53h01, anticorps wu:fb63c08, anticorps wu:fj64d01, anticorps zgc:123027, anticorps betaine--homocysteine S-methyltransferase, anticorps betaine--homocysteine S-methyltransferase L homeolog, anticorps betaine-homocysteine methyltransferase, anticorps betaine-homocysteine S-methyltransferase, anticorps BHMT, anticorps bhmt.L, anticorps Bhmt, anticorps bhmt

Sujet: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process