TSH receptor anticorps (N-Term)
-
- Antigène Voir toutes TSH receptor (TSHR) Anticorps
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSH receptor est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TSHR antibody was raised against the N terminal of TSHR
- Purification
- Purified
- Immunogène
- TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
- Top Product
- Discover our top product TSHR Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TSHR Blocking Peptide, catalog no. 33R-1711, is also available for use as a blocking control in assays to test for specificity of this TSHR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
- Autre désignation
- TSHR (TSHR Produits)
- Synonymes
- anticorps CHNG1, anticorps LGR3, anticorps hTSHR-I, anticorps AI481368, anticorps hypothroid, anticorps hyt, anticorps pet, anticorps TSHRA, anticorps TSH-R, anticorps thyroid stimulating hormone receptor, anticorps tshr, anticorps TSHR, anticorps Tshr
- Sujet
- TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-