SARDH anticorps (Middle Region)

N° du produit ABIN629761

Détail du produit anti-SARDH anticorps

Antigène: SARDH (Sarcosine Dehydrogenase (SARDH))

Épitope: Middle Region

Reactivité: Souris, Rat, Humain, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SARDH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SARDH antibody was raised against the middle region of SARDH

Purification: Purified

Immunogène: SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SARDH Blocking Peptide, catalog no. 33R-1982, is also available for use as a blocking control in assays to test for specificity of this SARDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SARDH

Antigène: SARDH (Sarcosine Dehydrogenase (SARDH))

Autre désignation: SARDH (SARDH Produits)

Synonymes: anticorps BPR-2, anticorps DMGDHL1, anticorps SAR, anticorps SARD, anticorps SDH, anticorps zgc:56363, anticorps sarcosine dehydrogenase, anticorps sarcosine dehydrogenase, mitochondrial, anticorps Sarcosine dehydrogenase, anticorps SARDH, anticorps SAV_6951, anticorps LOC5565677, anticorps LOC5572760, anticorps SDH, anticorps NGR_b16520, anticorps Sinme_2254, anticorps sardh, anticorps Sardh

Sujet: The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Poids moléculaire: 67 kDa (MW of target protein)