PCYT2 anticorps (C-Term)

N° du produit ABIN629765

L’anticorps Lapin Polyclonal anti-PCYT2 a été validé pour WB. Il convient pour détecter PCYT2 dans des échantillons de Humain et Souris.

Aperçu rapide pour PCYT2 anticorps (C-Term) (ABIN629765)

Antigène: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCYT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCYT2 anticorps

Épitope: C-Term

Specificité: PCYT2 antibody was raised against the C terminal of PCYT2

Purification: Purified

Immunogène: PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCYT2 Blocking Peptide, (ABIN940088), is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCYT2

Antigène: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Autre désignation: PCYT2

Sujet: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 43 kDa (MW of target protein)