PCYT2 anticorps (C-Term)
-
- Antigène Voir toutes PCYT2 Anticorps
- PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCYT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCYT2 antibody was raised against the C terminal of PCYT2
- Purification
- Purified
- Immunogène
- PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
- Top Product
- Discover our top product PCYT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCYT2 Blocking Peptide, catalog no. 33R-4702, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))
- Autre désignation
- PCYT2 (PCYT2 Produits)
- Synonymes
- anticorps ET, anticorps 1110033E03Rik, anticorps ethanolamine-phosphate cytidylyltransferase, anticorps putative ethanolamine-phosphate cytidylyltransferase, anticorps Ethanolamine-phosphate cytidylyltransferase, anticorps phosphate cytidylyltransferase 2, ethanolamine, anticorps phosphate cytidylyltransferase 2, ethanolamine L homeolog, anticorps Tc00.1047053511727.120, anticorps Tb11.01.5730, anticorps LINJ_32_0940, anticorps LOC5566800, anticorps LMJF_32_0890, anticorps EDI_013070, anticorps EDI_204270, anticorps CpipJ_CPIJ009320, anticorps Bm1_01855, anticorps pcy2, anticorps PCYT2, anticorps Pcyt2, anticorps pcyt2.L
- Sujet
- PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 43 kDa (MW of target protein)
-