ALT anticorps
-
- Antigène Voir toutes ALT Anticorps
- ALT (Alanine Aminotransferase (ALT))
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALT est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
- Top Product
- Discover our top product ALT Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALT (Alanine Aminotransferase (ALT))
- Autre désignation
- GPT (ALT Produits)
- Synonymes
- anticorps AAT1, anticorps ALT1, anticorps GPT1, anticorps GPT, anticorps Gpt1, anticorps An11g02620, anticorps AO090003000164, anticorps 233.t00009, anticorps 24.t00016, anticorps 1300007J06Rik, anticorps 2310022B03Rik, anticorps ALT, anticorps Gpt-1, anticorps AU021132, anticorps Dpagt2, anticorps Gnpta, anticorps gpt, anticorps ALANINE AMINOTRANSFERAS, anticorps AtAlaAT1, anticorps AtAlaATc, anticorps T13M22.3, anticorps T13M22_3, anticorps alanine aminotransferas, anticorps glutamic--pyruvic transaminase, anticorps glutamic-pyruvate transaminase (alanine aminotransferase), anticorps alanine aminotransferase, anticorps alanine aminotransferase 1, anticorps glutamic pyruvic transaminase, soluble, anticorps dolichyl-phosphate (UDP-N-acetylglucosamine) acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), anticorps alanine aminotransferase 2-like, anticorps Alanine aminotransferase 1, mitochondrial, anticorps GPT, anticorps Gpt, anticorps Tb927.1.3950, anticorps ANI_1_368094, anticorps AOR_1_284154, anticorps ALAT_1, anticorps ALAAT1, anticorps EHI_159710, anticorps EHI_096750, anticorps LOC5572541, anticorps ALAT, anticorps AAT2, anticorps Dpagt1, anticorps LOC100537633, anticorps AlaAT1
- Sujet
- GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
- Poids moléculaire
- 55 kDa (MW of target protein)
-