GMPPB anticorps (C-Term)

N° du produit ABIN629777

Détail du produit anti-GMPPB anticorps

Antigène: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GMPPB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GMPPB antibody was raised against the C terminal of GMPPB

Purification: Purified

Immunogène: GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GMPPB Blocking Peptide, catalog no. 33R-7838, is also available for use as a blocking control in assays to test for specificity of this GMPPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GMPPB

Antigène: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Autre désignation: GMPPB (GMPPB Produits)

Synonymes: anticorps MDDGA14, anticorps MDDGB14, anticorps MDDGC14, anticorps AI317178, anticorps E430010H19, anticorps RGD1560458, anticorps gmppl, anticorps zgc:92026, anticorps GMPPB, anticorps gmppb, anticorps gmppb-a, anticorps gmppb-b, anticorps GDP-mannose pyrophosphorylase B, anticorps GDP-mannose pyrophosphorylase B L homeolog, anticorps GDP-mannose pyrophosphorylase B S homeolog, anticorps GMPPB, anticorps Gmppb, anticorps gmppb, anticorps LOAG_13550, anticorps gmppb.L, anticorps gmppb.S

Sujet: GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Poids moléculaire: 43 kDa (MW of target protein)