TKTL2 anticorps (C-Term)

N° du produit ABIN629780

L’anticorps Lapin Polyclonal anti-TKTL2 a été validé pour WB. Il convient pour détecter TKTL2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TKTL2 anticorps (C-Term) (ABIN629780)

Antigène: TKTL2 (Transketolase-Like 2 (TKTL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TKTL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TKTL2 anticorps

Épitope: C-Term

Specificité: TKTL2 antibody was raised against the C terminal of TKTL2

Purification: Purified

Immunogène: TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TKTL2 Blocking Peptide, (ABIN5616622), is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TKTL2

Antigène: TKTL2 (Transketolase-Like 2 (TKTL2))

Autre désignation: TKTL2

Sujet: TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis

Poids moléculaire: 68 kDa (MW of target protein)