TIGD3 anticorps (N-Term)

N° du produit ABIN629782

Cet anticorps Lapin Polyclonal détecte spécifiquement TIGD3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TIGD3 anticorps (N-Term) (ABIN629782)

Antigène: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIGD3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TIGD3 anticorps

Épitope: N-Term

Specificité: TIGD3 antibody was raised against the N terminal of TIGD3

Purification: Purified

Immunogène: TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIGD3 Blocking Peptide, (ABIN5616602), is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIGD3

Antigène: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Autre désignation: TIGD3

Sujet: TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.

Poids moléculaire: 52 kDa (MW of target protein)