MKRN1 anticorps (N-Term)

N° du produit ABIN629785

Cet anticorps Lapin Polyclonal détecte spécifiquement MKRN1 dans WB. Il présente une réactivité envers Humain, Souris, Chien et Rat.

Aperçu rapide pour MKRN1 anticorps (N-Term) (ABIN629785)

Antigène: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MKRN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MKRN1 anticorps

Épitope: N-Term

Specificité: MKRN1 antibody was raised against the N terminal of MKRN1

Purification: Purified

Immunogène: MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MKRN1 Blocking Peptide, (ABIN938593), is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MKRN1

Antigène: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Autre désignation: MKRN1

Sujet: The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Chromatin Binding