GIPC2 anticorps (N-Term)

N° du produit ABIN629789

L’anticorps Lapin Polyclonal anti-GIPC2 a été validé pour WB et IHC. Il convient pour détecter GIPC2 dans des échantillons de Humain.

Aperçu rapide pour GIPC2 anticorps (N-Term) (ABIN629789)

Antigène: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GIPC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GIPC2 anticorps

Épitope: N-Term

Specificité: GIPC2 antibody was raised against the N terminal of GIPC2

Purification: Purified

Immunogène: GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIPC2 Blocking Peptide, (ABIN5613766), is also available for use as a blocking control in assays to test for specificity of this GIPC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GIPC2

Antigène: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Autre désignation: GIPC2

Sujet: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.

Poids moléculaire: 35 kDa (MW of target protein)