CES1 anticorps

N° du produit ABIN629796

Détail du produit anti-CES1 anticorps

Antigène: CES1 (Carboxylesterase 1 (CES1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CES1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxylesterase 1 Blocking Peptide, catalog no. 33R-1397, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CES1

Antigène: CES1 (Carboxylesterase 1 (CES1))

Autre désignation: Carboxylesterase 1 (CES1 Produits)

Synonymes: anticorps ACAT, anticorps CE-1, anticorps CEH, anticorps CES2, anticorps HMSE, anticorps HMSE1, anticorps PCE-1, anticorps REH, anticorps SES1, anticorps TGH, anticorps hCE-1, anticorps CESDD1, anticorps CES1, anticorps CES-K1, anticorps APLE, anticorps PMPMEase, anticorps CES, anticorps carboxylesterase 1, anticorps liver carboxylesterase 1, anticorps liver carboxylesterase, anticorps carboxylesterase 1 (monocyte/macrophage serine esterase 1), anticorps CES1, anticorps CpipJ_CPIJ013026, anticorps CpipJ_CPIJ016339, anticorps LOC100009551, anticorps LOC454097, anticorps LOC699486, anticorps LOC100050915

Sujet: CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process