MRGBP anticorps (N-Term)

N° du produit ABIN629797

Cet anticorps Lapin Polyclonal détecte spécifiquement MRGBP dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MRGBP anticorps (N-Term) (ABIN629797)

Antigène: MRGBP (MRG-Binding Protein (MRGBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRGBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MRGBP anticorps

Épitope: N-Term

Specificité: C20 ORF20 antibody was raised against the N terminal Of C20 rf20

Purification: Purified

Immunogène: C20 ORF20 antibody was raised using the N terminal Of C20 rf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF20 Blocking Peptide, (ABIN5612483), is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRGBP

Antigène: MRGBP (MRG-Binding Protein (MRGBP))

Autre désignation: C20ORF20

Sujet: C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

Poids moléculaire: 22 kDa (MW of target protein)