PKLR anticorps (N-Term)

N° du produit ABIN629803

Détail du produit anti-PKLR anticorps

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKLR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PKLR antibody was raised against the N terminal of PKLR

Purification: Purified

Immunogène: PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PKLR Blocking Peptide, catalog no. 33R-8888, is also available for use as a blocking control in assays to test for specificity of this PKLR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKLR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PKLR

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Autre désignation: PKLR (PKLR Produits)

Synonymes: anticorps PK1, anticorps PKL, anticorps PKR, anticorps PKRL, anticorps RPK, anticorps Pklg, anticorps wu:fd15e01, anticorps wu:fi37e08, anticorps pk1, anticorps PKLR, anticorps Pk-1, anticorps Pk1, anticorps R-PK, anticorps pklr, anticorps pyruvate kinase L/R, anticorps pyruvate kinase, liver and RBC, anticorps pyruvate kinase, liver and RBC L homeolog, anticorps pyruvate kinase liver and red blood cell, anticorps pyruvate kinase PKLR-like, anticorps PKLR, anticorps Pklr, anticorps pklr, anticorps pklr.L, anticorps LOC100621940

Sujet: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process