PHYHIP anticorps (N-Term)

N° du produit ABIN629804

L’anticorps Lapin Polyclonal anti-PHYHIP a été validé pour WB. Il convient pour détecter PHYHIP dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour PHYHIP anticorps (N-Term) (ABIN629804)

Antigène: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHYHIP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PHYHIP anticorps

Épitope: N-Term

Specificité: PHYHIP antibody was raised against the N terminal of PHYHIP

Purification: Purified

Immunogène: PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHYHIP Blocking Peptide, (ABIN5615355), is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHYHIP

Antigène: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Autre désignation: PHYHIP

Sujet: PHYHIP interacts with PHYH suggests a role in the development of the central system.

Poids moléculaire: 38 kDa (MW of target protein)