ADH6 anticorps

N° du produit ABIN629805

Détail du produit anti-ADH6 anticorps

Antigène: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH6 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH6 Blocking Peptide, catalog no. 33R-1184, is also available for use as a blocking control in assays to test for specificity of this ADH6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH6

Antigène: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Autre désignation: ADH6 (ADH6 Produits)

Synonymes: anticorps ADH1A, anticorps ADH1B, anticorps ADH-5, anticorps alcohol dehydrogenase 6 (class V), anticorps ADH6, anticorps Adh6

Sujet: ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.

Poids moléculaire: 32 kDa (MW of target protein)