HBZ anticorps (N-Term)

N° du produit ABIN629807

L’anticorps Lapin Polyclonal anti-HBZ a été validé pour WB et IHC. Il convient pour détecter HBZ dans des échantillons de Humain.

Aperçu rapide pour HBZ anticorps (N-Term) (ABIN629807)

Antigène: HBZ (Hemoglobin, zeta (HBZ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HBZ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-HBZ anticorps

Épitope: N-Term

Specificité: Hemoglobin Zeta antibody was raised against the N terminal of HBZ

Purification: Purified

Immunogène: Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Hemoglobin Zeta Blocking Peptide, (ABIN938088), is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HBZ

Antigène: HBZ (Hemoglobin, zeta (HBZ))

Autre désignation: Hemoglobin zeta

Sujet: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.

Poids moléculaire: 16 kDa (MW of target protein)