GINS1 anticorps

N° du produit ABIN629812

Cet anticorps Lapin Polyclonal détecte spécifiquement GINS1 dans WB. Il présente une réactivité envers Humain, Souris, Chien et Rat.

Aperçu rapide pour GINS1 anticorps (ABIN629812)

Antigène: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GINS1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GINS1 anticorps

Purification: Purified

Immunogène: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GINS1 Blocking Peptide, (ABIN5613762), is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GINS1

Antigène: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Autre désignation: GINS1

Sujet: The GINS complex plays an essential role in the initiation of DNA replication.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA