PPCDC anticorps (N-Term)

N° du produit ABIN629813

L’anticorps Lapin Polyclonal anti-PPCDC a été validé pour WB. Il convient pour détecter PPCDC dans des échantillons de Humain et Chien.

Aperçu rapide pour PPCDC anticorps (N-Term) (ABIN629813)

Antigène: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPCDC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPCDC anticorps

Épitope: N-Term

Specificité: PPCDC antibody was raised against the N terminal of PPCDC

Purification: Purified

Immunogène: PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPCDC Blocking Peptide, (ABIN5615490), is also available for use as a blocking control in assays to test for specificity of this PPCDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPCDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPCDC

Antigène: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Autre désignation: PPCDC

Sujet: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process