EXD (C-Term) anticorps

N° du produit ABIN629819

Détail du produit

Antigène: EXD

Épitope: C-Term

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: EXD antibody was raised against the C terminal Of Exd

Purification: Purified

Immunogène: EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: EXD

Synonymes: anticorps CG8933, anticorps DExd, anticorps Dm-EXD, anticorps Dmel\CG8933, anticorps Dpbx, anticorps EXD, anticorps Exd, anticorps Pbx1, anticorps anon-EST:fe1H3, anticorps l(1)IV, anticorps lincRNA.S9404, anticorps td48, anticorps extradenticle, anticorps exd

Sujet: As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.

Poids moléculaire: 42 kDa (MW of target protein)